PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9268_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 357aa    MW: 41822.4 Da    PI: 7.1356
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9268_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.64.6e-1192133446
                                          S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                          W + E++ll++++k++G g+W  +a+++g ++ + qc +++++
  cra_locus_9268_iso_5_len_1504_ver_3  92 WNAKEELLLLEGIKMYGFGNWYEVAEHVG-TKDRTQCLDHYNS 133
                                          *****************************.999999*****85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250249.2E-10120356IPR016827Transcriptional adaptor 2
SMARTSM002912.5E-62873IPR000433Zinc finger, ZZ-type
SuperFamilySSF578508.95E-133295No hitNo description
PfamPF005691.1E-63264IPR000433Zinc finger, ZZ-type
CDDcd023354.31E-173280No hitNo description
PROSITE profilePS501359.9693275IPR000433Zinc finger, ZZ-type
PROSITE patternPS0135703461IPR000433Zinc finger, ZZ-type
PROSITE profilePS5129320.33187139IPR017884SANT domain
SuperFamilySSF466892.17E-1287138IPR009057Homeodomain-like
SMARTSM007172.0E-888137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-891134IPR009057Homeodomain-like
PfamPF002491.2E-1091133IPR001005SANT/Myb domain
CDDcd001673.12E-992134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0016573Biological Processhistone acetylation
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MRSRERMSSD VEIMETAYAG EGQTVREEKV FYQCNYCNKD IYRKIHIKCL RCSDFNLCVE  60
CFSVAAEVYP HRSNHPYTVM DNLFFPLMCT DWNAKEELLL LEGIKMYGFG NWYEVAEHVG  120
TKDRTQCLDH YNSIYVHSPC VPVQEKYTEH LSMAHRQIIK DVSTKSVCDG NNALAEGAKR  180
APGVIESNDS HSKSKEDCNA EGSVREKQAR TSVEFVTEYG NDAQQLLADI EFKETDTDDE  240
RELKLRVLRF YSKRLDERKC RKKFLLERNL LHPHLVETYL SPEEKEICRP YRVFMRYHST  300
EEHANLLRTV VEEHRIRKRI QDLKDARAAG CRTPTEVERY IEQKSKRMKE STRAGPC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009803649.11e-136PREDICTED: transcriptional adapter ADA2-like isoform X3
RefseqXP_016449025.11e-136PREDICTED: transcriptional adapter ADA2-like isoform X2
SwissprotQ75LL61e-112TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLA0A103XLY91e-134A0A103XLY9_CYNCS; Homeodomain-like protein
STRINGGLYMA09G01501.11e-122(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24471215